What Is IGF-1 LR3?

IGF-1 LR3, also written Long R3 IGF-I or LR3-IGF-1, is a recombinant analogue of human insulin-like growth factor-1. It contains the full IGF-1 core with two major modifications:

• A 13-amino-acid N-terminal extension
• Replacement of glutamic acid at IGF-1 position 3 with arginine

Primary research themes

• IGF-1 receptor signaling
• Cell proliferation and survival
• Muscle-cell growth and differentiation
• Protein synthesis and mTOR signaling
• Glucose uptake and insulin-like actions
• Neural survival and neurogenesis
• Stem-cell and organoid culture
• Reduced regulation by IGF-binding proteins

🧬 Structure, Sequence, and Molecular Properties

🧪 Amino-acid sequence

MFPAMPLSSLFVNGRP TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

MFPAMPLSSLFVNGRPTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Disulfide architecture

Like native IGF-1, IGF-1 LR3 requires correct pairing of six cysteine residues into three disulfide bonds. Incorrect pairing can produce inactive or partially active isoforms even when intact mass and HPLC purity appear acceptable.

Protein rather than simple short peptide

At 83 residues with three disulfide bonds, IGF-1 LR3 behaves as a small recombinant protein. Its quality control requires folding, disulfide mapping, aggregation, host-cell impurity, and bioactivity testing beyond ordinary short-peptide analysis.

Why Was IGF-1 LR3 Engineered?

Reduced IGFBP binding

Native IGF-1 circulates largely bound to IGF-binding proteins. The LR3 modifications markedly reduce affinity for these proteins, leaving more analogue available to interact with receptors in experimental systems.

Increased apparent potency

Lower binding-protein sequestration can make LR3-IGF-1 substantially more potent than native IGF-1 in cell culture and selected in-vivo models.

Longer functional activity

Reduced IGFBP regulation and altered clearance can prolong biological activity compared with unmodified IGF-1.

Biotechnology utility

IGF-1 LR3 is widely used as a growth-factor reagent in serum-free media, stem-cell culture, muscle-cell research, and organoid systems.

📅 Development and Research Timeline

• 1950s–1970s: Somatomedin activity and IGF biology were characterized.
• 1980s: Recombinant human IGF-1 became available for experimental and clinical development.
• 1980s–1990s: Long R3 IGF-I was engineered to reduce IGF-binding-protein affinity and increase potency.
• 1990s–2000s: LR3-IGF-1 became widely used in cell culture, animal growth, muscle, metabolism, and biotechnology research.
• 2005: FDA approved mecasermin, unmodified recombinant human IGF-1, for severe primary IGF-1 deficiency in children.
• 2010s: IGF-1 LR3 continued to be used extensively in research but did not receive therapeutic approval.
• 2020s: Research included organoids, pluripotent stem cells, neurological models, muscle biology, and anti-doping detection.
• Current status: IGF-1 LR3 remains a research reagent and prohibited performance-enhancing growth factor.

🧠 How Does IGF-1 LR3 Work?

1. IGF-1 receptor activation

IGF-1R is a receptor tyrosine kinase consisting of extracellular alpha subunits and transmembrane beta subunits.

2. PI3K-AKT-mTOR pathway

This pathway supports protein synthesis, glucose transport, anti-apoptotic signaling, and cell growth.

3. RAS-MAPK pathway

MAPK signaling contributes to cell-cycle progression, proliferation, differentiation, and gene expression.

4. Insulin-like signaling

At sufficient concentrations, IGF-1 LR3 may activate insulin receptors and hybrid IGF-1R/insulin receptors, contributing to glucose-lowering effects.

5. Reduced extracellular regulation

Low affinity for IGF-binding proteins means LR3-IGF-1 is less constrained by normal extracellular IGF buffering.

🎯 Receptor Profile

IGF-Binding Proteins and Increased Bioactivity

Normal IGF regulation

Native IGF-1 is carried and regulated by six major IGF-binding proteins, especially IGFBP-3 in circulation.

LR3 resistance

The Arg3 substitution and N-terminal extension disrupt important IGFBP interaction surfaces.

Experimental consequence

More free analogue remains available to activate IGF-1R in cell-culture media and tissues.

Safety consequence

Reduced binding-protein buffering may also narrow the margin for error and increase hypoglycemic, mitogenic, or organ-growth effects.

Muscle Growth and Regeneration Research

Myoblast proliferation

IGF signaling promotes proliferation of muscle precursor cells before differentiation.

Myogenic differentiation

IGF-1 supports myotube formation, muscle-fiber maturation, and regeneration after injury.

Protein synthesis

AKT-mTOR signaling increases translation and can support hypertrophy in experimental systems.

Satellite cells

IGF pathways influence satellite-cell activation and muscle repair.

Performance claims

Although the pathway is anabolic, controlled evidence that unapproved IGF-1 LR3 safely improves athletic performance in humans is lacking.

Metabolic and Insulin-Like Effects

Glucose uptake

IGF-1 LR3 may increase glucose transport in muscle and other tissues through AKT-related pathways.

Hypoglycemia

Excess signaling can lower blood glucose dangerously, especially with fasting, insulin, diabetes drugs, or exercise.

Lipid and protein metabolism

IGF signaling can increase amino-acid uptake, protein synthesis, and nutrient storage.

Endocrine feedback

Exogenous IGF activity can alter growth-hormone secretion and the broader GH–IGF axis.

Neurological and Regenerative Research

Neuronal survival

IGF-1 pathways support neuronal survival, synaptic function, neurogenesis, and glial biology.

Alzheimer’s models

Intranasal LR3-IGF-1 has been studied in transgenic mouse models for cognition, amyloid pathology, and neuroinflammation.

Peripheral nerve research

IGF signaling contributes to axonal growth, Schwann-cell function, and neuromuscular recovery.

Human limitation

No approved neurological indication exists for IGF-1 LR3.

Cell Culture, Stem Cells, and Biotechnology

Serum-free media

LR3-IGF-1 is widely used to replace or reduce serum-derived growth signals.

Pluripotent stem cells

It supports growth and maintenance in selected human stem-cell media.

Organoids

IGF-1 LR3 can support growth and differentiation in organoid systems when combined with other defined factors.

Receptor-grade potency

Commercial research-grade materials are often qualified by proliferation assays using IGF-responsive cells such as MCF-7.

Research reagent versus medicine

A highly active cell-culture reagent is not automatically suitable for human administration.

Human Evidence

Native recombinant IGF-1

Mecasermin has human clinical data and an FDA-approved pediatric indication. Those data cannot be directly transferred to LR3-IGF-1 because LR3 has altered binding-protein affinity and pharmacology.

IGF-1 LR3 administration

There is no established therapeutic clinical program demonstrating safe, effective use of IGF-1 LR3 in humans.

Research use

Most LR3 evidence comes from receptor assays, cell culture, animal studies, biotechnology applications, and anti-doping literature.

Missing information

• Validated human dose
• Human half-life and clearance
• Long-term organ safety
• Clinical efficacy for muscle growth or recovery
• Cancer risk under repeated exposure
• Reproductive and developmental safety

Cancer and Proliferative-Risk Considerations

IGF-1R in cancer biology

The IGF-1R pathway promotes proliferation, survival, invasion, angiogenesis, and resistance to apoptosis in many cancer models.

Existing tumors

An IGF agonist could theoretically accelerate growth or survival of cells already carrying oncogenic changes.

Not proof of causation

This does not prove that IGF-1 LR3 initiates cancer, but it creates a substantial safety concern for unmonitored use.

Organ growth

Chronic excessive IGF signaling is associated with tissue and organ enlargement in disorders such as acromegaly.

Contraindication logic

Approved IGF-1 therapy includes malignancy-related precautions; unapproved LR3 use lacks a validated screening and monitoring framework.

FDA and Anti-Doping Status

FDA approval

IGF-1 LR3 is not FDA approved for any indication. FDA’s substance registry lists identity information but explicitly notes that a UNII does not imply approval.

Approved IGF-1 medicine

Mecasermin is FDA approved for severe primary IGF-1 deficiency in specific pediatric patients and is chemically distinct from LR3-IGF-1.

WADA prohibition

IGF-1, its analogues, and other growth factors affecting muscle, tendon, ligament, protein synthesis, and regeneration are prohibited at all times.

Research-use labeling

A “research use only” label does not establish safety, legality of administration, or sports compliance.

Potential Side Effects and Safety Considerations

Hypoglycemia

The most immediate risk is low blood glucose, which may cause sweating, tremor, confusion, seizure, loss of consciousness, or death.

Growth-related effects

• Soft-tissue enlargement
• Jaw, hand, or foot changes with chronic excess signaling
• Organ enlargement
• Edema and fluid retention
• Joint pain
• Carpal-tunnel-type symptoms

Neurological and ophthalmic risks

• Headache
• Intracranial hypertension
• Visual symptoms
• Sleep-disordered breathing related to tissue growth

Cardiovascular concerns

Chronic excessive IGF activity may affect cardiac muscle, rhythm, blood pressure, and fluid status.

Immunogenicity and impurities

Recombinant proteins can contain aggregates, misfolded isoforms, host-cell proteins, endotoxin, or sequence variants capable of changing safety and potency.

Cancer uncertainty

Potent activation of cell-survival and mitogenic pathways creates concern in people with known, occult, or high-risk malignancy.

🧪 Laboratory Testing Methods

📄 How to Interpret an IGF-1 LR3 COA

1. Confirm the complete 83-residue sequence.
2. Confirm the 13-residue N-terminal extension.
3. Confirm Arg at native IGF-1 position 3.
4. Verify intact mass near 9,118 Da.
5. Use LC-MS/MS peptide mapping with high sequence coverage.
6. Confirm all three correct disulfide bonds.
7. Measure monomer, dimer, and higher aggregates by SEC-HPLC.
8. Measure charge variants, clipping, oxidation, and deamidation.
9. Confirm receptor binding and IGF-1R phosphorylation potency.
10. Demonstrate reduced IGFBP binding compared with native IGF-1.
11. Assess insulin-receptor cross-reactivity.
12. Measure host-cell proteins, residual DNA, and endotoxin.
13. For finished injectables, require sterility, particles, fill accuracy, container closure, pH, osmolality, and in-use stability.
14. Do not treat research-grade LR3 as equivalent to mecasermin.
15. A COA does not establish human safety, efficacy, or FDA approval.

📊 Comparison Tables

IGF-1 LR3 vs Native IGF-1 vs Mecasermin vs IGF-1 DES

IGF-1 LR3 vs Growth Hormone

IGF-1 LR3 vs Insulin

Research-Grade LR3 vs Pharmaceutical Mecasermin

🖼️ Original Diagram Specifications

1. Protein architecture: 13-residue extension, Arg3 substitution, IGF-1 core, and three disulfide bonds.
2. IGFBP comparison: Native IGF-1 sequestered by IGFBPs versus freer LR3 analogue.
3. IGF-1R signaling: Receptor activation followed by PI3K-AKT-mTOR and RAS-MAPK pathways.
4. Muscle pathway: Satellite cells, protein synthesis, differentiation, and hypertrophy signaling.
5. Risk map: Hypoglycemia, organ growth, edema, intracranial hypertension, and tumor-cell signaling.
6. Comparison graphic: Native IGF-1, mecasermin, IGF-1 DES, and IGF-1 LR3.
7. COA workflow: Sequence, disulfide map, monomer, IGFBP resistance, receptor potency, host-cell impurities, and sterility.

❓ Frequently Asked Questions

Is IGF-1 LR3 a peptide?

Yes, though at 83 residues with three disulfide bonds it is more accurately handled as a small recombinant protein.

What does LR3 mean?

“Long” refers to the 13-residue N-terminal extension, and “R3” refers to arginine replacing glutamic acid at native IGF-1 position 3.

How many amino acids does it contain?

83.

What is its molecular weight?

Approximately 9,118 Da.

Does it contain disulfide bonds?

Yes, three correctly paired intramolecular disulfide bonds are required for native-like activity.

What receptor does it activate?

Primarily IGF-1R, with possible insulin-receptor and hybrid-receptor activity at sufficient exposure.

Why is it more potent than native IGF-1?

It has much lower affinity for IGF-binding proteins, leaving more free analogue available to activate receptors.

Is IGF-1 LR3 FDA approved?

No.

Is it the same as mecasermin?

No. Mecasermin is recombinant native human IGF-1 and has a specific approved pediatric indication.

Does it build muscle?

It activates anabolic pathways in cells and animals, but safe and effective human performance use has not been established.

Can it cause hypoglycemia?

Yes. Severe hypoglycemia is a major potential risk.

Is it prohibited in sports?

Yes. IGF-1 and its analogues are prohibited by WADA.

Does 95% or 99% purity prove activity?

No. Correct folding, disulfide pairing, monomer content, receptor potency, IGFBP resistance, and impurity testing are essential.

Can intact mass alone prove identity?

No. A misfolded or incorrectly disulfide-bonded protein may have the correct mass but poor or altered activity.

Is there an established human dose?

No FDA-approved or clinically validated dose exists for IGF-1 LR3.

Final Thoughts

IGF-1 LR3 is an engineered 83-amino-acid analogue designed to preserve IGF-1 receptor activity while escaping much of the normal regulation imposed by IGF-binding proteins. This makes it a highly potent and useful research reagent.

Its biological actions center on IGF-1R activation and downstream PI3K-AKT-mTOR and RAS-MAPK signaling. These pathways support protein synthesis, glucose uptake, cell survival, proliferation, differentiation, muscle development, and neural function.

The same potency that makes LR3 useful experimentally also creates substantial safety concerns. Reduced IGFBP buffering may increase hypoglycemia, organ-growth, edema, mitogenic, and cancer-related risks. There is no FDA-approved indication or validated human performance protocol.

Quality evaluation requires far more than peptide purity. A credible material must demonstrate the full 83-residue sequence, Arg3 substitution, N-terminal extension, correct three-disulfide structure, monomeric state, receptor potency, low IGFBP affinity, host-cell impurity control, endotoxin limits, and route-specific sterile-product quality. Research-grade IGF-1 LR3 is not interchangeable with pharmaceutical mecasermin.

📚 References

1. Bailes J, et al. Insulin-Like Growth Factor-1 and Its Monitoring in Medical and Performance Contexts. 2021.
2. R&D Systems. Recombinant Human LR3 IGF-I/IGF-1 Protein Characterization and Bioactivity Data.
3. Thermo Fisher Scientific. Recombinant Human IGF-I LR3 Protein Technical Data.
4. Qkine. Recombinant Human IGF-1 LR3 Protein Technical Information.
5. Francis GL, et al. Long R3 Insulin-Like Growth Factor-I: Design, Reduced Binding-Protein Affinity, and Increased Biological Potency.
6. Ballard FJ, et al. Long R3 IGF-I and IGF-Binding-Protein Resistance in Experimental Systems.
7. Philippou A, et al. Optimizing IGF-I for Skeletal Muscle Therapeutics. 2014.
8. Laron Z. Insulin-Like Growth Factor 1 as a Growth Hormone. 2001.
9. Weroha SJ, Haluska P. The IGF System in Cancer. 2012.
10. Varma Shrivastav S, et al. Insulin-Like Growth Factor Binding Protein-3 Biology. 2020.
11. Engel MG, et al. Intranasal Long R3 IGF-1 in an Alzheimer’s Disease Mouse Model. 2024.
12. U.S. Food and Drug Administration. Substance Registration System: Long-(Arg3) Insulin-Like Growth Factor-I.
13. U.S. Food and Drug Administration. Increlex Prescribing Information.
14. National Cancer Institute. IGF Definition and Growth-Signaling Overview.
15. World Anti-Doping Agency. 2026 Prohibited List.
16. USADA. World Anti-Doping Agency Prohibited List and Growth-Factor Guidance.
17. International Council for Harmonisation. ICH Q1A(R2), Q2(R2), Q3A, Q3B, Q3C, Q5C, Q6B.
18. United States Pharmacopeia General Chapters <621>, <71>, <85>, <788>, and applicable biotechnology-product chapters.

Sequence, structure, receptor biology, human evidence, safety, regulatory status, and analytical recommendations reviewed in July 2026.