What Is Sermorelin?

Sermorelin is a synthetic peptide corresponding to the first 29 amino acids of human growth hormone-releasing hormone, abbreviated GHRH. It is also called:

• GHRH(1-29)-NH₂
• Growth hormone-releasing factor 1-29
• GRF(1-29)-NH₂
• Sermorelin acetate

Major research and historical clinical uses

• Testing pituitary growth-hormone reserve
• Diagnosing selected forms of growth-hormone deficiency
• Stimulating growth in some children with preserved pituitary function
• Studying GH pulsatility
• Evaluating age-related changes in the somatotropic axis
• Research involving sleep, body composition, muscle, and metabolism

🧬 Structure, Sequence, and Molecular Properties

🧪 Amino-acid sequence

H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH₂

YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂

C-terminal amidation

The peptide ends in Arg-NH₂ rather than a free carboxyl group. Amidation is essential to the defined sermorelin identity and affects mass, charge, stability, and receptor activity.

Methionine oxidation

Met27 is susceptible to oxidation, producing a +16 Da impurity that may change chromatographic behavior and biological potency.

Acetate-salt correction

Commercial material is frequently supplied as an acetate salt. Net peptide content must be corrected for acetate, water, and residual solvents rather than inferred from total powder weight.

Relationship to Native Human GHRH

Shortest fully active region

The first 29 amino acids of human GHRH contain the principal receptor-activating sequence. Sermorelin retains this active N-terminal region while omitting residues 30–44.

Native GHRH sequence

Human GHRH is a 44-amino-acid hypothalamic peptide. Tesamorelin uses the full 44-residue sequence with an added N-terminal modification, whereas sermorelin uses the shorter 1–29 fragment with a C-terminal amide.

Rapid enzymatic degradation

The unmodified N terminus is vulnerable to dipeptidyl peptidase-IV and other proteases. Sermorelin is therefore relatively short acting compared with stabilized analogues.

Dependence on pituitary function

Sermorelin can stimulate GH only when functioning pituitary somatotrophs remain. Severe pituitary destruction or complete GH deficiency may produce little or no response.

📅 Discovery and Regulatory Timeline

• 1982: Human pancreatic-tumor GHRH was isolated and characterized, advancing understanding of hypothalamic GH control.
• Mid-1980s: GHRH(1-29)-NH₂ was shown to stimulate GH release through intravenous, subcutaneous, and intranasal routes.
• Early 1990s: Geref Diagnostic was FDA approved to evaluate pituitary GH-secretory capacity.
• 1997: Geref Pediatric received FDA approval for short stature associated with pediatric growth-hormone deficiency.
• 1990s: Trials evaluated growth velocity, pituitary priming, immune markers, body composition, and aging-related GH decline.
• 2008: The manufacturer discontinued production for commercial reasons.
• June 2009: FDA withdrew approvals of the two sermorelin NDAs after discontinuation.
• 2010s–2020s: Sermorelin continued to be offered through compounding and wellness settings, commonly for unapproved adult uses.
• 2026: No currently marketed FDA-approved sermorelin drug exists, and WADA continues to prohibit sermorelin as a GHRH analogue.

🧠 How Does Sermorelin Work?

1. GHRH receptor activation

Sermorelin binds GHRH receptors on anterior-pituitary somatotroph cells.

2. Cyclic-AMP signaling

Receptor activation increases intracellular cyclic AMP and protein kinase A activity.

3. Calcium-dependent secretion

Downstream ion-channel and calcium changes support exocytosis of stored GH.

4. GH gene transcription

Repeated GHRH receptor stimulation can increase GH synthesis and pituitary reserve.

5. IGF-1 production

Released GH stimulates hepatic and tissue production of IGF-1, which mediates many growth and anabolic effects.

🎯 Receptor Profile

Selective endocrine effect

Classic human studies generally found GH release without major direct changes in prolactin, thyroid hormones, gonadotropins, ACTH, cortisol, insulin, or glucagon after single diagnostic exposures.

Growth Hormone and IGF-1 Axis

Physiologic pulsatility

Growth hormone is released episodically, with the largest pulses often occurring during slow-wave sleep.

Hypothalamic control

GHRH stimulates GH secretion, while somatostatin inhibits it. Ghrelin-receptor signaling can amplify release.

Feedback regulation

GH and IGF-1 feed back to the hypothalamus and pituitary to limit further secretion.

Age-related decline

GH pulse amplitude and IGF-1 concentrations generally decline with aging, but this physiologic change is not automatically a disease requiring treatment.

Incomplete pituitary function

Sermorelin may be most effective when hypothalamic GHRH signaling is impaired but pituitary somatotrophs remain capable of releasing GH.

Diagnostic Research and Historical Use

Provocative GH testing

Geref Diagnostic was historically used as an intravenous challenge to evaluate whether the pituitary could release GH.

Interpretive limitation

A response to GHRH does not perfectly distinguish hypothalamic from pituitary disease and may produce false-normal results in some patients with GH deficiency.

Factors affecting response

• Age
• Obesity
• Hyperglycemia
• Elevated free fatty acids
• Hypothyroidism
• Somatostatin-active drugs
• Glucocorticoids
• Insulin and hypoglycemia
• Clonidine and levodopa

Current diagnostic alternatives

Modern evaluation may use insulin tolerance, glucagon stimulation, macimorelin, arginine-based testing, or other endocrinology-directed methods depending on the patient and region.

Pediatric Growth Research

Short stature and GH deficiency

Clinical studies evaluated daily or multiple-daily sermorelin in children with idiopathic or hypothalamic GH deficiency.

Growth velocity

Some children showed increased height velocity, particularly those with mild deficiency and preserved pituitary responsiveness.

Comparison with recombinant GH

In several studies, recombinant GH produced more consistent or stronger growth outcomes, especially in severe deficiency.

Response variability

Children with complete pituitary GH failure are less likely to respond because sermorelin requires endogenous GH production.

Antibody formation

Anti-GHRH antibodies developed in some historical studies, although major clinical consequences were not consistently observed.

Adult and Healthy-Aging Research

Older-adult studies

Small randomized studies of GHRH analogues in adults aged roughly 55–71 years reported activation of the GH–IGF-1 axis.

Sex-specific findings

Some studies found increases in lean mass, insulin sensitivity, well-being, libido, or skin thickness, with inconsistent effects between men and women.

Immune markers

Exploratory work reported changes in selected immune measures after prolonged GHRH analogue administration.

Evidence limitations

These studies were small, short, and often involved analogues such as [Nle27]GHRH(1-29)-NH₂ rather than standard sermorelin itself.

No anti-aging approval

No FDA-approved indication exists for age-related GH decline, vitality, sleep, body composition, or longevity.

Body Composition, Muscle, and Metabolic Research

Lean body mass

Small studies of GHRH analogues have reported modest increases in lean mass in selected older adults.

Muscle strength and bioenergetics

Research has explored whether nightly GHRH can influence muscle strength and energy metabolism, but findings are preliminary.

Fat mass

Growth-hormone signaling can promote lipolysis, but sermorelin has not been established as an obesity or weight-loss treatment.

Glucose metabolism

GH can reduce insulin sensitivity, while improved body composition may produce competing effects. Human responses vary.

Not equivalent to tesamorelin

Tesamorelin has randomized evidence for visceral-fat reduction in HIV lipodystrophy. Sermorelin does not have an equivalent approved body-composition indication.

Sleep and GH Pulsatility Research

Nocturnal GH secretion

GH pulses are closely linked to slow-wave sleep, especially in younger individuals.

Nightly administration rationale

Some research used evening dosing to align GHRH stimulation with normal nocturnal physiology.

Sleep claims remain uncertain

Evidence does not establish sermorelin as an approved treatment for insomnia, sleep quality, or sleep disorders.

Sleep-disordered breathing

Excessive GH and IGF-1 signaling can contribute to soft-tissue changes and may worsen obstructive sleep apnea in susceptible individuals.

Major Evidence Limitations

• No currently marketed FDA-approved sermorelin product
• Historical approvals do not automatically validate modern compounded formulations
• Adult anti-aging evidence is small and inconsistent
• Some frequently cited studies used modified GHRH analogues rather than exact sermorelin
• No established obesity or weight-loss indication
• No validated athletic-recovery or muscle-building indication
• Requires preserved pituitary function
• Short plasma half-life and rapid degradation
• Human long-term safety data for chronic wellness use are limited
• Commercial compounded products may vary in sequence, salt, potency, sterility, and content
• No FDA-reviewed current finished-product specification exists

Current FDA and Anti-Doping Status

Historical FDA approval

Sermorelin acetate was previously approved for GH diagnostic testing and pediatric short stature associated with GH deficiency.

Withdrawal

The manufacturer discontinued production for commercial reasons, and FDA withdrew the approvals in June 2009.

Current compounded products

Compounded sermorelin is not an FDA-approved product and has not undergone the same premarket review for safety, effectiveness, manufacturing consistency, or labeling.

WADA prohibition

The 2026 World Anti-Doping Agency Prohibited List specifically includes sermorelin among prohibited GHRH analogues.

Potential Side Effects, Contraindications, and Safety Considerations

Historically reported adverse effects

• Injection-site pain, redness, or swelling
• Facial flushing
• Headache
• Nausea or vomiting
• Metallic taste or dysgeusia
• Pallor
• Chest tightness

Growth-axis effects

• Elevated IGF-1
• Fluid retention and edema
• Arthralgia and myalgia
• Carpal-tunnel-type symptoms
• Glucose intolerance
• Soft-tissue growth

Malignancy concern

GH and IGF-1 support cell growth and survival. Chronic stimulation may be inappropriate in active malignancy or in people at elevated oncologic risk without specialist evaluation.

Pituitary or intracranial disease

Patients with pituitary tumors, prior cranial irradiation, intracranial lesions, or disrupted hypothalamic-pituitary anatomy require specialist assessment.

Pregnancy and pediatric use

Current compounded use should not be inferred from the former product’s historical indications. Pregnancy, pediatric use, and endocrine disorders require formal medical oversight.

Product-quality risk

Potential hazards include incorrect sequence, oxidation, deamidation, nonamidated peptide, endotoxin, microbial contamination, particulates, inaccurate net content, or poor sterile technique.

🧪 Laboratory Testing Methods

📄 How to Interpret a Sermorelin COA

1. Confirm the exact 29-residue sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR.
2. Confirm C-terminal amidation: Arg-NH₂.
3. Verify the free N-terminal Tyr1.
4. Confirm molecular formula C₁₄₉H₂₄₆N₄₄O₄₂S.
5. Verify average molecular weight near 3,357.9 Da.
6. Use LC-MS/MS mapping rather than intact mass alone.
7. Confirm all residues are in the intended L configuration.
8. Measure Met27 oxidation separately.
9. Measure deamidation, clipping, deletion peptides, and nonamidated material.
10. State acetate-salt form and counterion content.
11. Report net sermorelin free-base content after correcting for water and acetate.
12. Measure monomer, aggregates, and particles.
13. Use GHRH-receptor binding and cAMP potency assays.
14. Include protease-stability testing when pharmacology is relevant.
15. For finished injectables, require sterility, endotoxin, particles, pH, osmolality, fill accuracy, container closure, and post-reconstitution stability.
16. Do not assume compounded sermorelin is equivalent to former Geref products.
17. A COA does not establish FDA approval, human efficacy, or suitability for administration.

📊 Comparison Tables

Sermorelin vs Tesamorelin vs CJC-1295 vs Ipamorelin

Sermorelin vs Recombinant Growth Hormone

Sermorelin vs Macimorelin for GH Testing

Compounded Sermorelin vs Former Geref

🖼️ Original Diagram Specifications

1. Sequence map: Native GHRH(1-44) with the sermorelin 1-29 region highlighted and C-terminal amidation labeled.
2. GHRH-receptor pathway: Pituitary receptor, cAMP, GH pulse, liver IGF-1, and peripheral tissues.
3. Pituitary-dependence graphic: Preserved somatotroph function versus complete pituitary GH deficiency.
4. Historical-use timeline: Diagnostic approval, pediatric approval, discontinuation, and withdrawal.
5. Evidence pyramid: Historical pediatric and diagnostic data, small aging studies, limited modern wellness evidence.
6. Risk map: IGF-1 elevation, glucose changes, edema, joint symptoms, malignancy, and product-quality risks.
7. COA workflow: Sequence, amidation, Met oxidation, acetate correction, receptor potency, sterility, and stability.

❓ Frequently Asked Questions

Is sermorelin a peptide?

Yes. It is a synthetic 29-amino-acid fragment of human GHRH.

What is the exact sequence?

YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂.

What is its molecular formula?

C₁₄₉H₂₄₆N₄₄O₄₂S.

What is its molecular weight?

Approximately 3,357.9 Da.

What receptor does sermorelin activate?

The pituitary growth hormone-releasing hormone receptor.

Is sermorelin FDA approved?

It was previously approved under the Geref name, but the products were discontinued and the approvals were withdrawn in 2009. No currently marketed FDA-approved sermorelin product exists.

Why was Geref withdrawn?

The manufacturer discontinued production for commercial reasons; available FDA records do not indicate withdrawal for safety or effectiveness concerns.

What was sermorelin approved for?

Historically, GH diagnostic testing and treatment of short stature associated with pediatric GH deficiency.

Is sermorelin approved for anti-aging?

No.

Does sermorelin increase growth hormone?

Yes, when functioning pituitary somatotroph cells are present.

Does it increase IGF-1?

It may increase IGF-1 through endogenous GH release.

Is sermorelin the same as tesamorelin?

No. Sermorelin is amidated GHRH(1-29); tesamorelin is a modified full-length GHRH(1-44) analogue.

Is sermorelin the same as growth hormone?

No. Sermorelin stimulates endogenous GH release; recombinant GH supplies the hormone directly.

Can sermorelin help if the pituitary cannot produce GH?

Response may be poor or absent when pituitary somatotroph function is severely impaired.

Is sermorelin prohibited in sports?

Yes. WADA specifically prohibits sermorelin as a GHRH analogue.

Does 99% HPLC purity prove high quality?

No. Sequence, amidation, oxidation, net content, acetate, potency, endotoxin, sterility, and stability must also be assessed.

Final Thoughts

Sermorelin is the amidated 1–29 fragment of human GHRH and represents the shortest sequence retaining full GHRH receptor activity. It stimulates endogenous pituitary GH secretion through GHRH-receptor, cyclic-AMP, and protein-kinase-A signaling.

Its historical medical role is well documented. Sermorelin acetate was previously approved for provocative GH testing and for selected children with short stature associated with GH deficiency. The products were later discontinued commercially, and FDA withdrew the approvals in 2009.

Modern claims involving anti-aging, fat loss, bodybuilding, recovery, sleep, or adult GH optimization extend beyond the former approved uses. Small studies of GHRH analogues in older adults reported mixed body-composition, metabolic, muscle, skin, and immune findings, but they do not establish a broad wellness indication.

Quality evaluation requires confirmation of the complete YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂ sequence, C-terminal amidation, correct stereochemistry, Met27 oxidation, deamidation and truncation impurities, acetate-corrected net content, GHRH-receptor potency, sterility, and stability. Current compounded material is not automatically equivalent to the former FDA-approved Geref product.

📚 References

1. U.S. Food and Drug Administration. Geref Approval and Supplemental Approval Documents.
2. U.S. Food and Drug Administration. Tesamorelin Medical Review: Prior Geref Diagnostic and Geref Pediatric Approval History. 2010.
3. U.S. Food and Drug Administration. Macimorelin Medical Review: Sermorelin Discontinuation and Withdrawal History. 2017.
4. U.S. Food and Drug Administration. Pharmacy Compounding Advisory Committee Briefing Materials. October 2024.
5. FDA Orphan Drug Designations and Approvals Database. Sermorelin Acetate / Geref.
6. KEGG Drug. Sermorelin, D08509.
7. NCATS GSRS. Sermorelin Acetate Substance Record.
8. Prakash A, Goa KL. Sermorelin: A Review of Its Use in the Diagnosis and Treatment of Children With Idiopathic Growth Hormone Deficiency. BioDrugs. 1999.
9. Esposito P, et al. PEGylation of Growth Hormone-Releasing Hormone (GRF) Analogue. Advanced Drug Delivery Reviews. 2003.
10. Vance ML, et al. Effects of GHRH(1-29)-NH₂ on Growth Hormone Secretion in Normal Men. 1986.
11. Barron JL, et al. Growth Hormone-Releasing Hormone(1-29)-NH₂ and Stimulation of GH Secretion in Normal Men. 1985.
12. Wilton P, et al. Pharmacology of GHRH(1-29)-NH₂ in Healthy Men. 1993.
13. Neyzi O, et al. GHRH(1-29)-NH₂ Compared With Growth Hormone in Children With GH Deficiency. 1993.
14. Kirk JM, et al. Treatment With GHRH(1-29)-NH₂ in Children With Idiopathic Short Stature. 1994.
15. Ross RJ, et al. Treatment of Growth-Hormone Deficiency With GHRH(1-29)-NH₂. Lancet. 1987.
16. Khorram O, et al. Endocrine and Metabolic Effects of Long-Term GHRH Analogue Administration in Older Adults. Journal of Clinical Endocrinology & Metabolism. 1997.
17. Vittone J, et al. Effects of Nightly GHRH Injections on Muscle Strength and Bioenergetics in Older Adults. 1997.
18. Khorram O, et al. Effects of GHRH Analogue Administration on the Immune System of Aging Adults. 1997.
19. World Anti-Doping Agency. 2026 Prohibited List.
20. USADA. What Athletes Should Know About Sermorelin. 2025.
21. International Council for Harmonisation. ICH Q1A(R2), Q2(R2), Q3A, Q3B, Q3C, Q5C, and Q6B.
22. United States Pharmacopeia General Chapters <621>, <71>, <85>, and <788>.

Sequence, chemistry, historical FDA status, research evidence, safety, anti-doping status, and analytical recommendations reviewed in July 2026.