What Is LL-37?

LL-37 is the only known human cathelicidin antimicrobial peptide. It is generated by proteolytic cleavage of the precursor protein hCAP18, encoded by the CAMP gene.

The name comes from its first two amino acids—leucine and leucine—and its length of 37 amino-acid residues.

Major biological roles

• Direct microbial membrane disruption
• Neutralization and binding of bacterial products such as LPS
• Immune-cell recruitment and chemotaxis
• Regulation of inflammatory signaling
• Biofilm inhibition
• Keratinocyte and fibroblast migration
• Angiogenesis and wound repair
• Interaction with nucleic acids and pattern-recognition receptors

🧬 Structure, Sequence, and Molecular Properties

🧪 Amino-acid sequence

[LL-37, 37 aa]

Structural characteristics

• 37 amino-acid residues
• Linear peptide with no disulfide bridge
• Strongly cationic because of multiple lysine and arginine residues
• Amphipathic, meaning hydrophobic and positively charged surfaces segregate when the peptide forms an alpha helix
• Can form monomers, dimers, tetramers, and other oligomeric assemblies depending on concentration and environment
• Structure changes in water, salt solutions, membranes, and microbial surfaces

⚛️ Molecular properties

How Does the Body Produce LL-37?

hCAP18 precursor

LL-37 is stored as part of the inactive precursor hCAP18. Cleavage releases the active C-terminal LL-37 peptide.

Major sources

• Neutrophils
• Monocytes and macrophages
• Keratinocytes
• Airway epithelial cells
• Gastrointestinal epithelial cells
• Salivary and reproductive tissues

Regulation

Expression is influenced by infection, inflammation, tissue injury, cytokines, and vitamin-D-receptor signaling.

Proteolytic processing

Different tissues can produce LL-37 fragments with altered antimicrobial, inflammatory, and cytotoxic properties.

📅 Discovery and Research Timeline

• 1990s: Human cathelicidin hCAP18 and its active C-terminal peptide LL-37 were characterized.
• 2000s: Research expanded from antimicrobial activity to chemotaxis, receptor signaling, wound repair, and biofilm biology.
• 2010s: LL-37 became linked to psoriasis, rosacea, lupus-related nucleic-acid signaling, angiogenesis, and tissue-dependent cancer effects.
• 2014: A small randomized clinical study reported that topical LL-37 was generally well tolerated and improved healing predictors in chronic venous leg ulcers at lower tested doses.
• 2014 onward: Intratumoral LL-37 was evaluated in an early melanoma study to explore immune stimulation and dose selection.
• 2020s: Research increasingly focuses on delivery systems, stable analogues, nanoparticles, wound dressings, antimicrobial combinations, and reducing host-cell toxicity.
• Current status: No FDA-approved synthetic LL-37 therapeutic exists.

🧠 How Does LL-37 Work?

1. Electrostatic membrane binding

Bacterial membranes contain negatively charged phospholipids, lipopolysaccharide, and lipoteichoic acid. Positively charged LL-37 is attracted to these surfaces.

2. Membrane disruption

LL-37 inserts into microbial membranes and can create transient lesions or pores, disturb lipid organization, and cause leakage of cellular contents.

3. Intracellular microbial effects

After membrane access, LL-37 may interact with nucleic acids, proteins, and metabolic systems.

4. Toxin and endotoxin binding

LL-37 can bind LPS and other microbial components, changing how innate immune receptors respond.

5. Host receptor signaling

Reported signaling partners include FPR2, P2X7, EGFR transactivation pathways, and other membrane-associated systems. Effects depend heavily on cell type, concentration, and local environment.

6. Nucleic-acid transport

LL-37 can form complexes with self-DNA or RNA and deliver them to intracellular Toll-like receptors. This can strengthen antimicrobial sensing but also contribute to autoimmune inflammation.

Antibacterial, Antifungal, and Antiviral Research

Antibacterial activity

LL-37 has demonstrated activity against many Gram-positive and Gram-negative organisms in vitro, including resistant pathogens.

Antifungal activity

Experimental activity has been reported against Candida and other fungi.

Antiviral activity

LL-37 may bind viral envelopes, disrupt membranes, aggregate particles, alter viral entry, and regulate antiviral immune responses.

Physiologic-environment limitation

Activity often falls in the presence of salts, serum proteins, mucus, wound fluid, DNA, and proteases. Strong activity in a simple laboratory buffer may not translate to human tissue.

Host-cell toxicity

The same membrane-active properties that damage microbes can injure mammalian cells at sufficiently high concentrations.

Biofilm Research

Biofilm prevention

LL-37 can reduce microbial attachment, interfere with early biofilm formation, and alter bacterial signaling.

Established biofilms

Activity against mature biofilms is variable and often weaker than prevention of initial formation.

Combination strategies

Researchers study LL-37 with antibiotics, nanoparticles, hydrogels, wound dressings, and modified fragments to improve local activity.

Resistance considerations

Although membrane-active peptides attack multiple targets, bacteria can still resist LL-37 through surface-charge changes, proteases, efflux, capsules, and biofilm matrices.

Immune and Inflammatory Signaling

Chemotaxis

LL-37 can recruit neutrophils, monocytes, mast cells, T cells, and other immune populations.

Inflammation can increase or decrease

Depending on context, LL-37 can suppress excessive responses to microbial products or amplify cytokine and interferon pathways.

Innate-adaptive immune bridge

LL-37 influences dendritic-cell maturation, antigen presentation, leukocyte migration, and cytokine production.

Extracellular-DNA complexes

LL-37 protects nucleic acids from degradation and facilitates entry into immune cells, contributing to type-I-interferon signaling in psoriasis and lupus-related models.

Concentration and tissue determine effect

Low local concentrations may support repair and defense, while persistent or excessive expression may sustain inflammation.

Wound-Healing and Angiogenesis Research

Re-epithelialization

LL-37 promotes keratinocyte migration and may activate EGFR-related repair pathways.

Fibroblast activity

It can influence fibroblast migration, extracellular-matrix production, and wound contraction.

Angiogenesis

LL-37 promotes endothelial-cell responses and new blood-vessel formation through several signaling pathways.

Chronic venous leg ulcers

A small randomized topical study found acceptable tolerability and favorable healing-related effects at lower tested doses, while the highest tested exposure was less favorable.

Delivery challenge

Proteases in chronic wound fluid can degrade LL-37. Modern approaches use hydrogels, nanoparticles, dressings, peptide analogues, and sustained-release systems.

Skin Disease, Psoriasis, and Rosacea

Protective skin defense

LL-37 contributes to antimicrobial defense and barrier repair.

Psoriasis

LL-37 forms complexes with self-DNA and RNA, enabling activation of TLR9, TLR7, and TLR8 pathways and type-I-interferon signaling. High lesional LL-37 may therefore contribute to disease pathogenesis.

Rosacea

Abnormal processing and increased activity of cathelicidin peptides are implicated in inflammation, vascular changes, and lesion formation.

Atopic dermatitis

Reduced antimicrobial-peptide activity may contribute to infection susceptibility in some patients, although disease biology is complex.

Not a universal skin treatment

Because LL-37 can improve repair yet worsen inflammatory signaling, disease-specific context is essential.

Gut, Respiratory, and Systemic Research

Respiratory tract

LL-37 participates in airway antimicrobial defense, mucus biology, inflammatory signaling, and epithelial repair.

Gastrointestinal tract

Research includes barrier function, microbial ecology, inflammatory bowel disease, and epithelial repair.

Sepsis and endotoxin research

LL-37 can neutralize LPS but can also produce systemic toxicity depending on concentration and delivery.

Autoimmune disease

LL-37–nucleic-acid complexes are studied in systemic lupus erythematosus, psoriasis, and other interferon-driven disorders.

Vitamin D connection

Vitamin-D signaling can increase CAMP expression, linking endocrine status to innate immune defense.

Cancer Research: Protective and Tumor-Promoting Effects

Potential anticancer actions

LL-37 and selected fragments can disrupt tumor-cell membranes, induce apoptosis, modify immune responses, and enhance drug delivery in some experimental models.

Potential tumor-promoting actions

In other tissues, LL-37 may stimulate proliferation, angiogenesis, migration, inflammatory signaling, and recruitment of tumor-supportive cells.

Tissue dependence

Research has associated LL-37 with tumor promotion in several ovarian, breast, lung, pancreatic, prostate, melanoma, and squamous-cell models, while inhibitory effects have been reported in some gastric, colon, hematologic, and other systems.

Intratumoral melanoma study

An early clinical study investigated intratumoral LL-37 to determine dose and immune effects in melanoma. This does not establish a general anticancer indication.

No established oncology role

LL-37 is not an approved cancer treatment, immune adjuvant, or preventive therapy.

Human Clinical Research

Chronic leg ulcers

Topical LL-37 was evaluated in a small randomized controlled study. Lower tested doses appeared safe and were associated with improved healing predictors; the dose-response was not simply “more is better.”

Melanoma

An early intratumoral study explored safety, dose, and immune activation.

Biomarker research

Endogenous LL-37 has been measured in infections, inflammatory disorders, autoimmune disease, wounds, cardiovascular disease, and cancer.

What has not been established

• Safe systemic or injectable dose
• Long-term repeated-use safety
• Approved treatment for chronic infection
• Approved “immune boosting” use
• Validated oral or nasal systemic therapy
• Generalized wound-healing indication

Major Evidence Limitations

• Many antimicrobial results come from simplified in-vitro conditions
• Serum, salts, mucus, DNA, and proteases can reduce activity
• Host-cell toxicity overlaps with antimicrobial potency
• Human trials are small and route specific
• Endogenous-expression studies do not prove benefit from administering synthetic peptide
• Pro-inflammatory and anti-inflammatory effects vary by context
• Cancer effects are tissue dependent and sometimes opposing
• Peptide stability and delivery remain major obstacles
• Commercial research preparations may differ in salt, purity, aggregation, and biological potency

Potential Side Effects and Safety Considerations

No approved systemic safety profile

There is no validated systemic dose, injection schedule, therapeutic window, or long-term safety program for synthetic LL-37.

Potential direct toxicity

• Hemolysis
• Membrane damage to host cells
• Local pain, irritation, or tissue injury
• Inflammatory-cell activation
• Endothelial and epithelial toxicity at high exposure

Potential immune risks

• Immunogenicity and anti-drug antibodies
• Excess cytokine or interferon signaling
• Aggravation of psoriasis, rosacea, lupus-related pathways, or other inflammatory disease
• Unpredictable effects in immunocompromised patients

Angiogenesis and cancer concern

LL-37 can promote blood-vessel growth and proliferation in some contexts. This creates theoretical and experimentally supported concerns in certain cancers and proliferative disorders.

FDA compounding concern

FDA has specifically identified LL-37 as a bulk substance that may present significant safety risks because of immunogenicity, peptide-related impurities, and insufficient human safety information.

🧪 Laboratory Testing Methods

📄 How to Interpret an LL-37 COA

1. Verify the exact 37-residue sequence: [LL-37, 37 aa]
2. Confirm intact molecular mass near 4493.3 Da.
3. Use MS/MS peptide mapping: HPLC plus intact mass is insufficient.
4. Confirm L-amino-acid stereochemistry and screen for epimerization.
5. State the salt form: TFA, acetate, or another counterion.
6. Report net peptide content after correcting for water and counterions.
7. Measure deletion peptides and oxidation products.
8. Assess aggregation and concentration-dependent oligomerization.
9. Test antimicrobial potency under physiologically relevant salt and serum conditions.
10. Include hemolysis and mammalian-cell cytotoxicity.
11. For wound research, include protease stability in wound fluid.
12. For any parenteral research, require endotoxin, sterility, particles, and container-closure controls.
13. Do not interpret a COA as proof of human safety, efficacy, or FDA equivalence.

📊 Comparison Tables

LL-37 vs Thymosin Alpha-1 vs KPV vs BPC-157

LL-37 vs Human Defensins

LL-37 vs Conventional Antibiotics

Raw LL-37 vs Research-Qualified Material

🖼️ Original Diagram Specifications

1. Peptide architecture: 37-residue sequence displayed as hydrophobic and positively charged faces of an alpha helix.
2. Precursor processing: CAMP gene → hCAP18 → protease cleavage → LL-37.
3. Microbial killing: Electrostatic binding, membrane insertion, pore formation, and leakage.
4. Immune signaling: FPR2, P2X7, EGFR, TLR nucleic-acid complexes, chemotaxis, and cytokines.
5. Wound repair: Keratinocyte migration, fibroblasts, angiogenesis, antimicrobial defense, and re-epithelialization.
6. Benefit–risk balance: Host defense and healing opposite cytotoxicity, autoimmune inflammation, angiogenesis, and cancer complexity.
7. COA workflow: Sequence, HRMS, peptide mapping, salt correction, aggregation, antimicrobial potency, hemolysis, sterility, and stability.

❓ Frequently Asked Questions

Is LL-37 a peptide?

Yes. It is a naturally occurring 37-amino-acid human host-defense peptide.

What does LL-37 stand for?

Its first two residues are leucine-leucine, and it contains 37 amino acids.

What is the sequence?

[LL-37, 37 aa]

What is the molecular formula?

Approximately C₂₀₅H₃₄₀N₆₀O₅₃ for the parent peptide.

What is the molecular weight?

Approximately 4493.3 Da.

Is LL-37 FDA approved?

No synthetic LL-37 drug is FDA approved.

Is LL-37 an antibiotic?

It has direct antimicrobial activity but is more accurately described as a multifunctional host-defense peptide.

Does LL-37 break biofilms?

It can inhibit biofilm formation and sometimes affect established biofilms, but activity varies greatly by organism and conditions.

Does LL-37 promote wound healing?

Preclinical and limited human topical research suggests it can support re-epithelialization and repair, but no broad approved wound indication exists.

Can LL-37 worsen inflammation?

Yes. It can amplify nucleic-acid sensing and interferon pathways in psoriasis and other autoimmune contexts.

Is LL-37 anticancer?

Its effects are tissue dependent. It can suppress some tumor models and promote others.

Can LL-37 damage human cells?

Yes, especially at higher concentrations or under certain exposure conditions.

Does a high HPLC purity prove potency?

No. Physiologic antimicrobial activity, immune signaling, aggregation, cytotoxicity, and net peptide content must also be evaluated.

Can endogenous LL-37 research prove injected LL-37 is beneficial?

No. Natural local production and external systemic administration are biologically different.

Is there an established injectable dose?

No.

Final Thoughts

LL-37 is one of the most biologically complex antimicrobial peptides. It does much more than kill microbes: it recruits immune cells, binds microbial toxins and nucleic acids, regulates inflammation, affects angiogenesis, and participates in epithelial and wound repair.

This multifunctionality is also its central challenge. The same properties that support host defense can damage host membranes, intensify autoimmune signaling, encourage pathologic angiogenesis, or alter tumor behavior. Its effects depend on concentration, tissue, route, microbial environment, proteases, salts, serum proteins, and disease context.

Human topical wound research provides an important proof of concept, but synthetic LL-37 remains unapproved and lacks a validated systemic dose or long-term safety profile. FDA has specifically highlighted insufficient safety information, immunogenicity concerns, and peptide-characterization complexity for compounded LL-37.

Analytical verification requires more than a purity percentage. A credible evaluation must confirm the full 37-residue sequence, intact mass, stereochemistry, salt form, net peptide content, oxidation, truncations, aggregation, physiologically relevant antimicrobial potency, host-cell cytotoxicity, hemolysis, protease stability, endotoxin, and microbiological quality.

📚 References

1. Voronko OE, et al. Antimicrobial Peptides of the Cathelicidin Family: Focus on LL-37. International Journal of Molecular Sciences. 2025.
2. Kuroda K, Okumura K, Isogai H, Isogai E. The Human Cathelicidin Antimicrobial Peptide LL-37 and Mimics Are Potential Anticancer Drugs. Frontiers in Oncology. 2015.
3. Ridyard KE, Overhage J. The Potential of Human Peptide LL-37 as an Antimicrobial Agent. Antibiotics. 2021.
4. Xhindoli D, et al. The Human Cathelicidin LL-37—A Pore-Forming Antibacterial Peptide and Host-Cell Modulator. Biochimica et Biophysica Acta. 2016.
5. Duplantier AJ, van Hoek ML. The Human Cathelicidin LL-37 as a Potential Treatment for Polymicrobial Infected Wounds. Frontiers in Immunology. 2013.
6. Grönberg A, et al. Treatment with LL-37 Is Safe and Effective in Enhancing Healing of Hard-to-Heal Venous Leg Ulcers. Wound Repair and Regeneration. 2014.
7. Morizane S, et al. Cathelicidin Antimicrobial Peptide LL-37 in Psoriasis Enables Keratinocyte Reactivity against TLR9 Ligands. Journal of Investigative Dermatology. 2012.
8. Lande R, et al. Plasmacytoid Dendritic Cells Sense Self-DNA Coupled with Antimicrobial Peptide. Nature. 2007.
9. Ganguly D, et al. Self-RNA–Antimicrobial Peptide Complexes Activate Human Dendritic Cells through TLR7 and TLR8. Journal of Experimental Medicine. 2009.
10. Piktel E, et al. The Role of Cathelicidin LL-37 in Cancer Development. Archivum Immunologiae et Therapiae Experimentalis. 2016.
11. Lu F, et al. Repurposing Human Antibacterial Peptide LL-37 for Cancer Treatment. Frontiers in Pharmacology. 2022.
12. ClinicalTrials.gov. Intratumoral Injections of LL37 for Melanoma. NCT02225366.
13. U.S. Food and Drug Administration. Certain Bulk Drug Substances for Use in Compounding That May Present Significant Safety Risks: Cathelicidin LL-37.
14. Yang D, et al. LL-37, the Neutrophil Granule- and Epithelial Cell-Derived Cathelicidin, Utilizes FPRL1 as a Receptor to Chemoattract Human Peripheral Blood Neutrophils, Monocytes, and T Cells. Journal of Experimental Medicine. 2000.
15. Tokumaru S, et al. Induction of Keratinocyte Migration via Transactivation of the EGFR by LL-37. Journal of Immunology. 2005.
16. Koczulla R, et al. An Angiogenic Role for the Human Peptide Antibiotic LL-37/hCAP-18. Journal of Clinical Investigation. 2003.
17. Salzer S, et al. Antimicrobial Peptide LL-37 and Angiogenesis Signaling. Arteriosclerosis, Thrombosis, and Vascular Biology.
18. Overhage J, et al. Human Host Defense Peptide LL-37 Prevents Bacterial Biofilm Formation. Infection and Immunity. 2008.
19. Turner J, et al. Activities of LL-37, a Cathelin-Associated Antimicrobial Peptide of Human Neutrophils. Antimicrobial Agents and Chemotherapy. 1998.
20. Johansson J, et al. Conformation-Dependent Antibacterial Activity of LL-37. Journal of Biological Chemistry. 1998.
21. Oren Z, et al. Structure and Organization of the Human Antimicrobial Peptide LL-37 in Membranes. Biochemical Journal.
22. Wang G, et al. Structure, Dynamics, and Antimicrobial Activity of LL-37. Journal of Biological Chemistry.
23. Wu WKK, et al. Emerging Roles of the Host Defense Peptide LL-37 in Human Cancer and Its Potential Therapeutic Applications. International Journal of Cancer. 2010.
24. Chen X, et al. Roles and Mechanisms of Human Cathelicidin LL-37 in Cancer. Cellular Physiology and Biochemistry. 2018.
25. Campbell GR, Spector SA. Vitamin D Inhibits Human Immunodeficiency Virus Type 1 and Mycobacterium tuberculosis Infection in Macrophages through the Induction of Autophagy. PLoS Pathogens.
26. Gombart AF, et al. A Human Cathelicidin Antimicrobial Peptide Gene Is a Direct Target of the Vitamin D Receptor. FASEB Journal.
27. Sørensen OE, et al. Processing of Seminal Plasma hCAP-18 to ALL-38 by Gastricsin. Journal of Biological Chemistry.
28. Yamasaki K, et al. Increased Serine Protease Activity and Cathelicidin Promotes Skin Inflammation in Rosacea. Nature Medicine. 2007.
29. Reinholz M, et al. The Clinical Significance of Cathelicidin in Inflammatory Skin Disease. Dermatology.
30. Hancock REW, Haney EF, Gill EE. The Immunology of Host Defence Peptides: Beyond Antimicrobial Activity. Nature Reviews Immunology. 2016.
31. Mookherjee N, et al. Modulation of the TLR-Mediated Inflammatory Response by the Endogenous Human Host Defense Peptide LL-37. Journal of Immunology.
32. Scott MG, et al. An Anti-Infective Peptide That Selectively Modulates the Innate Immune Response. Nature Biotechnology.
33. Currie SM, et al. The Human Cathelicidin LL-37 Has Antiviral Activity against Respiratory Viruses. PLoS One.
34. Tripathi S, et al. The Human Cathelicidin LL-37 Inhibits Influenza A Viruses. PLoS One.
35. Xi L, et al. Cathelicidin LL-37 Promotes Wound Healing in Diabetic Models. Peptides. 2024.
36. Neshani A, et al. Decoding LL-37: Structure and Antimicrobial Mechanisms. Drug Resistance Updates. 2025.
37. Wu Y, et al. Antimicrobial Peptides for Skin Wound Healing. 2025.
38. International Council for Harmonisation. ICH Q1A(R2), Q2(R2), Q3A, Q3B, Q3C, and Q6B.
39. United States Pharmacopeia General Chapters <621>, <71>, <85>, and <788>.

Chemistry, antimicrobial and immunomodulatory mechanisms, wound healing, inflammatory and cancer biology, clinical research, FDA safety position, and analytical recommendations were reviewed in July 2026.